PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00085_0320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 591aa    MW: 63600.1 Da    PI: 8.574
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00085_0320genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-173075147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     + +W++eEd llv++v+++G  +W++Ia+ +  gR+ k+c++rw + 
    kfl00085_0320 30 KSSWSPEEDRLLVELVRKHGAQSWSLIAKQIA-GRSNKSCRLRWCNQ 75
                     578*****************************.***********985 PP

2Myb_DNA-binding58.91.1e-1882127148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      + ++T++Ed  l+ a++++G++ W++Ia++++ gRt++ +k++w++yl
    kfl00085_0320  82 KEPFTPDEDRALLAAHERHGNK-WAAIAKELP-GRTDNAIKNHWNSYL 127
                      679*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.3622576IPR017930Myb domain
SuperFamilySSF466899.33E-3128123IPR009057Homeodomain-like
SMARTSM007172.4E-152978IPR001005SANT/Myb domain
PfamPF002491.1E-163075IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-253283IPR009057Homeodomain-like
CDDcd001672.54E-143274No hitNo description
PROSITE profilePS5129428.25477131IPR017930Myb domain
SMARTSM007178.9E-1881129IPR001005SANT/Myb domain
PfamPF002492.7E-1782127IPR001005SANT/Myb domain
CDDcd001672.11E-1484127No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2484130IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MRATSCDLGV SYSPATLGPN SPTAGVKTPK SSWSPEEDRL LVELVRKHGA QSWSLIAKQI  60
AGRSNKSCRL RWCNQLNPEV RKEPFTPDED RALLAAHERH GNKWAAIAKE LPGRTDNAIK  120
NHWNSYLARK APGAQRDLPG ATPPAAESAS REGRKGAAAR SPSTKRVSQQ WEGDRNLHKK  180
IKSNDVASPN APFDIFSPPP SELQNSTSPP QEASSGLPPP SPFHAHTSGH PPHSGFLTSF  240
ASLPPRSQST SPEAEFSTRR PFSSAGDLAS PRGFPWSRAH LPNGAHFVKP IRPQALRCQP  300
ESAALASVVM QFLPSFGAPP LPSESDSSGE PTDGSARRAE LREHVIAEYL KLTTAMAKAT  360
AGASASYVLS NPSPTPSGFP HFLPFAAHPG IRLSPPHLPK SASTSHMAAL ELEPQRGFRK  420
PRLDVLATPS AFAALSLGSP CGPPPAEEGP SGREEGGERC SPTKVGEADV AEAEEGARTD  480
SGDEDEQEEK PRLKELRLMD MPDRRADALQ ARVRDPRFRW AEPHATADYE KLGEPSRDEA  540
ESTCGPSWTV PTLHWVRRRS SMVCKTLQLS DAAAAASLDF APARGIPGYP A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-35301307107B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.15e-41myb domain protein 70